PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_14558A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 263aa    MW: 29293.1 Da    PI: 6.1596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_14558AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89e-171461148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               rg+WT+eEd++l++ +  +G  +W+++++  g+ R++k+c++rw +yl
  Oropetium_20150105_14558A 14 RGPWTAEEDKKLINFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                               89******************************99************97 PP

2Myb_DNA-binding52.71e-1671111547
                                -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                T+ E+++ +d++++lG++ W++Ia++++ gRt++++k++w+++
  Oropetium_20150105_14558A  71 TAAEEQIVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111
                                899***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.4E-22563IPR009057Homeodomain-like
PROSITE profilePS5129413.498961IPR017930Myb domain
SuperFamilySSF466891.59E-2711108IPR009057Homeodomain-like
SMARTSM007172.4E-131363IPR001005SANT/Myb domain
PfamPF002492.0E-151461IPR001005SANT/Myb domain
CDDcd001671.27E-101661No hitNo description
PROSITE profilePS5129427.30562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.1E-2564117IPR009057Homeodomain-like
SMARTSM007179.2E-1566114IPR001005SANT/Myb domain
CDDcd001673.68E-1271112No hitNo description
PfamPF002491.5E-1471111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MGRQPCCDQQ GVKRGPWTAE EDKKLINFIL THGRCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKHGLL TAAEEQIVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG  120
INPATHQLLD NMKAATLQSS MDTIESAKSS NTGDMQSLKE GNQETVPIPT DSSEQSSWLE  180
QTNNACSANI DPVMNWQLEE DLPIDEPWLN FLSGNNDEVG IVADPLPSEG AMDWLLDYQD  240
FGMYSSNLVG RPTVHSSDGS NL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004974137.11e-140PREDICTED: protein ODORANT1-like
SwissprotQ50EX64e-84ODO1_PETHY; Protein ODORANT1
TrEMBLA0A0A9PV631e-137A0A0A9PV63_ARUDO; Uncharacterized protein
STRINGGRMZM2G138427_P011e-126(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP7938563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G12350.13e-81myb domain protein 42